PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla007696
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family GeBP
Protein Properties Length: 407aa    MW: 46340.8 Da    PI: 5.047
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla007696genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.61.9e-38182276397
     DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                ++rlwse+Dei++LqG+idf+  +g++p+ d++ f +f+k+++s++vsk+ql++K+rrLKkK+k++++k ++g++p+f k+h++k+f lskkiWg
  Cla007696 182 INRLWSEDDEISILQGMIDFQLAKGSDPYTDMSLFLDFIKENLSVDVSKNQLIDKVRRLKKKYKNNSEKGRNGDDPVFLKQHEHKSFVLSKKIWG 276
                68********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.4E-33183276IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MAPKRLVEDL PSFHAFSDAE EESDYETHED PEIDNLMQNS EDENEEQTQE DDEEEEQEEQ  60
EQEQEHEQAI RSPIISKREN SLEKDSGFVS DSDSEKTQSS PSASAFTIKP IIRKLACGSS  120
KPKKDSHKSS IDCATVKPVS SGSKRPIENN FQGNESNKKK IKRGVMNGED IEEGKKVSGS  180
GINRLWSEDD EISILQGMID FQLAKGSDPY TDMSLFLDFI KENLSVDVSK NQLIDKVRRL  240
KKKYKNNSEK GRNGDDPVFL KQHEHKSFVL SKKIWGNEAK KKPRKQSVKA SNSVSISSPR  300
VDVEAGKKEI VNNNNVESKI LPEEFLSEYP WLKASFMVEN DKFCSEGLMR LVRERMPLIG  360
SEKAKELDDK WRKLGESELE LYVKKVDLVR EQCKLILDSM GKAKRAT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455395.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0A0K1N40.0A0A0A0K1N4_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-29DNA-binding storekeeper protein-related transcriptional regulator